PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g035010.1
Common NameMTR_1g035010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 1004aa    MW: 111688 Da    PI: 7.6059
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g035010.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.62.4e-40103180178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +Cqv++C++dls+ak+yhrrhkvCe+hska+++l+ +++qrfCqqCsrfh l efDe+krsCrrrLa+hn+rrrk+q+
  Medtr1g035010.1 103 MCQVDNCKEDLSKAKDYHRRHKVCEAHSKASKALLGNQMQRFCQQCSRFHPLVEFDEGKRSCRRRLAGHNRRRRKTQP 180
                      6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.0E-3498165IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.718101178IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-37102183IPR004333Transcription factor, SBP-box
PfamPF031101.3E-29104177IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.202.8E-4751889IPR020683Ankyrin repeat-containing domain
CDDcd002046.81E-5797894No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1004 aa     Download sequence    Send to blast
MEKVAPPLLP LHPPMLSSHQ FYDSSNTKKR DLLSSYDVVH IPNDNWNPKE WNWDSIRFMT  60
AKSTTVEPQQ VEESLNLNLG STGLVRPNKR IRSGSPTSAS YPMCQVDNCK EDLSKAKDYH  120
RRHKVCEAHS KASKALLGNQ MQRFCQQCSR FHPLVEFDEG KRSCRRRLAG HNRRRRKTQP  180
DEVAVGGSPP LNQVAANLEI FNLLTAIADG SQGKFEERRS QVPDKEQLVQ ILNRIPLPAD  240
LTAKLLDVGN NLNAKNDNVQ METSPSYHHR DDQLNNAPPA PLTKDFLAVL STTPSTPARN  300
GGNGSTSSAD HMRERSSGSS QSPNDDSDCQ EDVRVKLPLQ LFGSSPENDS PSKLPSSRKY  360
FSSESSNPVD ERTPSSSPPV VEMNFGLQGG IRGFNSNCIS TGFGGNANKE TSQSHSCTTI  420
PLDLFKGSKS NNMIQQSSSV QSVPFKAGYA SSGSDYSPPS LNSDTQDRTG RIMFKLFDKH  480
PSHFPGTLRT QIYNWLSTRP SDLESYIRPG CVVLSIYASM SSAAWVQLEE NFLQRVDSLI  540
HNSDSDFWRN GRFLVYSGSQ LASHKDGRIR MCKPWGTWRS PELISVSPLA IVGGQETSIS  600
LKGRNLSAPG TKIHCTGADC YTSSEVIGSG DPGMVYDEIK LSGFEVQNTS PSVLGRCFIE  660
VENGFKGNSF PVIIANASIC KELRPLESEF DEEEKMCDAI SEEHEHHFGR PKSRDEALHF  720
LNELGWLFQR ERFSNVHEVP DYSLDRFKFV LTFSVERNCC MLVKTLLDML VDKHFEGEGL  780
STGSVEMLKA IQLLNRAVKR KCTSMVDLLI NYSITSKNDT SKKYVFPPNL EGPGGITPLH  840
LAASTTDSEG VIDSLTNDPQ EIGLKCWETL ADENGQTPHA YAMMRNNHSY NMLVARKCSD  900
RQRSEVSVRI DNEIEHPSLG IELMQKRINQ VKRVGDSCSK CAIAEVRAKR RFSGSRSWLH  960
GPFIHSMLAV AAVCVCVCVL FRGTPYVGSV SPFRWENLNY GTM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-3294177184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.148860.0root| seed| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1407740.0AC140774.7 Medicago truncatula clone mth2-5e11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003589683.10.0squamosa promoter-binding-like protein
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLG7IA230.0G7IA23_MEDTR; Squamosa promoter-binding-like protein
STRINGGLYMA07G19770.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]